Sequence and characterization of a sperm-specific histone H1-like protein of Mytilus californianus.

نویسندگان

  • S Carlos
  • L Jutglar
  • I Borrell
  • D F Hunt
  • J Ausio
چکیده

The major protein fraction of the protamine-like PL-II* (phi 2B) from the sperm of Mytilus californianus has been sequenced and characterized. Immunological and sequence analyses unequivocally show that this protein is indeed a member of the histone H1 family. Along with proteins of the histone H1 class, the protein also shows cross-reactivity and sequence identity, in its NH2-terminal region, with the major protamine-like protein component of Mytilus sperm: PL-III (phi 1), of smaller molecular mass. Indeed it is the unusual repetitive sequence motif of the NH2-terminal domain of PL-II* that bestows to this protein its protamine-like nature. Fourier-transform infrared spectroscopy spectroscopy indicates that the protein contains considerable secondary structure: 18% alpha-helix, 21% beta-sheet, 39% turns and bends, 22% random coil. At the higher levels of structure, PL-II* exhibits ionic strength-dependent folding which is indistinguishable from that of histone H5, as monitored by fluorescence anisotropy.

برای دانلود متن کامل این مقاله و بیش از 32 میلیون مقاله دیگر ابتدا ثبت نام کنید

ثبت نام

اگر عضو سایت هستید لطفا وارد حساب کاربری خود شوید

منابع مشابه

Primary, secondary, and tertiary structure of the core of a histone H1-like protein from the sperm of Mytilus.

We have analyzed the structure of the trypsin-resistant core of the protein PL-II* of the sperm from Mytilus californianus. The peptide has a molecular mass of 8436 Da and its primary sequence is ATGGAKKP STLSMIVAAIQAMKNRKGSSVQAIRKYILANNKG INTSRLGSAMKLAFAKGLKSGVLVRPKTSAGA SGATGSFRVG. This sequence bears an enormous homology and fulfills the constraints of the consensus sequence of the trypsin-r...

متن کامل

Common phylogenetic origin of protamine-like (PL) proteins and histone H1: Evidence from bivalve PL genes.

Sperm nuclear basic proteins (SNBPs) can be grouped into three main categories: histone (H) type, protamine (P) type, and protamine-like (PL) type. Protamine-like SNBPs represent the most structurally heterogeneous group, consisting of basic proteins which are rich in both lysine and arginine amino acids. The PL proteins replace most of the histones during spermiogenesis but to a lesser extent ...

متن کامل

The effect of aspirin on the interaction of histone 05 and 05-DNA

The linker histones (H1 or H5) which play a key role in the folding of chromatin, are general repressors of gene expression. Nuclei of the mature chicken erythrocytes (and in some mammalian cells) contain both of them. Although the interaction of H5 with DNA is stronger than that of H1, it does not prevent the transcription of some erythroid-specific genes. It has been shown that some modificat...

متن کامل

P-116: Absence of JMJD1A, A Testis- Specific Histone Demethylase, in Tissue Samples of TESE Negative Men

Background During mammalian spermatogenesis unique and dynamic epigenetic events occur leading to chromatin condensation. Through these events, histone demethylases such as JMJD1A play important roles in compaction of sperm chromatin, due to regulation of histone methylation dynamics and alteration of chromatin structure. As �histone methylation� is one of the best-characterized modifications i...

متن کامل

P-209: Decreased Expression of Histone Acetyltransferase CDY1 Gene in Testis Tissue May Lead to Decreased Expression of Transition Protein (TNP) and Protamine (PRM) Genes,Causing Male Infertility

Background: Infertility is a complex medical problem. About 15% of couples are infertile, and male infertility being involved in roughly 50% of the cases. Among these, many cases are associated with a severe impairment of spermatogenesis. During the last stage of spermatogenesis (spermiogenesis), sperm chromatin endures complex modifications in which histones are lost and depositioned with tran...

متن کامل

ذخیره در منابع من


  با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید

برای دانلود متن کامل این مقاله و بیش از 32 میلیون مقاله دیگر ابتدا ثبت نام کنید

ثبت نام

اگر عضو سایت هستید لطفا وارد حساب کاربری خود شوید

عنوان ژورنال:
  • The Journal of biological chemistry

دوره 268 1  شماره 

صفحات  -

تاریخ انتشار 1993